Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

1,996 – 2,010 of 115,704 results

1,996

Novus Biologicals™ Recombinant Human TANK His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

1,997

Novus Biologicals™ Recombinant Human HSPC132 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

1,998

Novus Biologicals™ Recombinant Human TOMM34 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

1,999

R&D Systems™ Recombinant Viral Dengue Virus 4 NS1 Protein

R&D Systems™ Recombinant Viral Dengue Virus 4 NS1 Protein CF is a non-structural protein that is a viral glycoprotein.

Pricing & Availability

2,000

Novus Biologicals™ APIP Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	SDS-PAGE
Purity or Quality Grade	>85%
Conjugate	Unconjugated
Common Name	APIP
Storage Requirements	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
For Use With (Application)	SDS-PAGE
Source	Human

2,001

Novus Biologicals™ NANP Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	NANP
Molecular Weight (g/mol)	31.9kDa
Gene ID (Entrez)	140838
Formulation	Liquid. 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 2mM DTT, 100mM NaCl
Immunogen	NANP, 1-248aa. Sequence: MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMGLSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSIDCKVSMST
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

2,002

Novus Biologicals™ Recombinant Human ZNHIT1 His Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability
Specifications

Purity or Quality Grade	>95%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Gene Alias	CG1I, CGBP1, Cyclin-G1-binding protein 1, H_DJ0747G18.14, p18 Hamlet, p18Hamlet, putative cyclin G1 interacting protein, zinc finger HIT domain-containing protein 1, Zinc finger protein subfamily 4A member 1, zinc finger protein, subfamily 4A (HIT domain containing), member 1, zinc finger, HIT domain containing 1, zinc finger, HIT type 1, zinc finger, HIT-type containing 1, ZNFN4A1
Common Name	ZNHIT1
Molecular Weight (g/mol)	TMW: 19.9kDa
Gene ID (Entrez)	10467
Formulation	20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 0.4M UREA
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

2,003

Novus Biologicals™ Recombinant Human TUSC2 His Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability

2,004

Novus Biologicals™ Recombinant Human COX5A His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

2,005

Novus Biologicals™ Recombinant Human DNTTIP1 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

2,006

Novus Biologicals™ Recombinant Human SYCE3 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

2,007

Novus Biologicals™ Recombinant Human FUCA2 His Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability
Specifications

Purity or Quality Grade	>85%, by SDS-PAGE
Conjugate	Unconjugated
Gene Alias	Alpha-L-fucosidase 2, Alpha-L-fucoside fucohydrolase 2, dJ20N2.5, EC 3.2.1.51, fucosidase, alpha-L- 2, plasma, MGC1314, plasma alpha-L-fucosidase
Common Name	FUCA2
Molecular Weight (g/mol)	TMW: 53.3kDa
Gene ID (Entrez)	2519
Formulation	20mM phosphate (pH8.0) containing 10% glycerol
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

2,008

Novus Biologicals™ Recombinant Human RAB3IL1 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>90%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Gene Alias	GRAB, guanine nucleotide exchange factor for Rab3A, guanine nucleotide exchange factor for Rab-3A, RAB3A interacting protein (rabin3)-like 1, Rab-3A-interacting-like protein 1, Rab3A-interacting-like protein 1, Rabin3-like 1
Common Name	RAB3IL1
Molecular Weight (g/mol)	TMW: 45kDa
Gene ID (Entrez)	5866
Formulation	Phosphate buffer saline (pH 7.4) containing 50% glycerol
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.25mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

2,009

Novus Biologicals™ Recombinant Human Cleavage Stimulation Factor Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability
Specifications

Conjugate	Unconjugated
Molecular Weight (g/mol)	49.1 kDa
Gene Symbol	CSTF1
Endotoxin Concentration	<1.0 EU per 1μg of protein (determined by LAL method)
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	SDS-PAGE
Source	Baculovirus
Name	Recombinant Human cleavage stimulation factor Protein
Regulatory Status	RUO
Purification Method	>90%, by SDS-PAGE
Gene Alias	CF-1 50 kDa subunit, Cleavage stimulation factor 50 kDa subunit, cleavage stimulation factor subunit 1, cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kD, cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa, CSTF 50 kDa subunit, CstF-50, CstF
Product Type	Recombinant Protein
Gene ID (Entrez)	1477
Formulation	Liquid. PBS (pH 7.4) containing 1mM DTT, 20% glycerol
Cross Reactivity	Human
Recombinant	Recombinant

2,010

Novus Biologicals™ Recombinant Human SCN3B His Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability
Specifications

Conjugate	Unconjugated
Molecular Weight (g/mol)	16.8 kDa
Gene Symbol	SCN3B
Endotoxin Concentration	< 1.0 EU per 1 microgram of protein (determined by LAL method)
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	SDS-PAGE
Source	Baculovirus
Name	Recombinant Human SCN3B Protein
Regulatory Status	RUO
Purification Method	>90%, by SDS-PAGE
Gene Alias	HSA243396, KIAA1158, SCNB3, sodium channel subunit beta-3, sodium channel, voltage-gated, type III, beta, voltage-gated sodium channel beta-3 subunit
Product Type	Recombinant Protein
Gene ID (Entrez)	55800
Formulation	Liquid. PBS (pH 7.4) containing 10% glycerol
Cross Reactivity	Human
Recombinant	Recombinant

Prev
1
...
132
133
134
135
...
7,714
Next

Welcome to fishersci.com

Recombinant Proteins

Filtered Search Results

Narrow Results

Novus Biologicals™ Recombinant Human TANK His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human HSPC132 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human TOMM34 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ APIP Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ NANP Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human ZNHIT1 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human TUSC2 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human COX5A His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human DNTTIP1 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human SYCE3 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human FUCA2 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human RAB3IL1 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human Cleavage Stimulation Factor Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human SCN3B His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human TANK His Protein

Novus Biologicals™ Recombinant Human HSPC132 His Protein

Novus Biologicals™ Recombinant Human TOMM34 His Protein

Novus Biologicals™ APIP Protein

Novus Biologicals™ NANP Protein

Novus Biologicals™ Recombinant Human ZNHIT1 His Protein

Novus Biologicals™ Recombinant Human TUSC2 His Protein

Novus Biologicals™ Recombinant Human COX5A His Protein

Novus Biologicals™ Recombinant Human DNTTIP1 His Protein

Novus Biologicals™ Recombinant Human SYCE3 His Protein

Novus Biologicals™ Recombinant Human FUCA2 His Protein

Novus Biologicals™ Recombinant Human RAB3IL1 His Protein

Novus Biologicals™ Recombinant Human Cleavage Stimulation Factor Protein

Novus Biologicals™ Recombinant Human SCN3B His Protein